Difference of Gene Expression Profiles between Barrett’s Esophagus and Cardia Intestinal Metaplasia by Gene Chip

Theincidenceofadenocarcinomaintheesoph agusandgastroesophagealjunction(GEJ)isin creasingforthetwodecadesinNorthAmericaandEurope[1].Barrett'sesophagus(BE)isthoughttobeapremalignantconditionforesophagealadeno carcinomaandmostofadenocarcinomasatGEJ[2].Recentlythepresenceofcardiaintestinalmetapla sia(CIM)insomenormalappearingGEJhasbeendescribed[3].TherelationofthisconditiontoBEhasnotyetbeeninvestigated.Inthisexperiment,wehadperformedoura nalysisonthree4096chipsinordertoacquirethedifference…     

Treatment of Hepatitis Caused by Cytomegalovirus with Allitridin Injection──An Experimental Study

Hepatitiscausedbyhumancy-tQmegalovirus(HCMV)isquitecommona-monginfantsinChina.ltusuallylastsforseveralmonthsandevencausesthedeathinseverecongenitallyinfectedpatients['].Al-thoughganciclovirhasbeenusedasana-gentofchoicetotreatadults'CMVhepati-tisthatdevelopedafterorgantransplanta-tion[2],side-effectssuchasmyelotoxicitylimititsuseininfants[3].ItwasreportedthatgarlicextractcouldinhibitthegrowthofCMVADl69(strainforroutinelaborato-rywork)invitro[4J,whichmeantthattheremaybeanalternativesubstan…     

Antiviral Activity of Silkworm Expressed Recombinant Human Macrophage Colony-Stimulating Factor in Vitro and Its Mechanism

Macrophagecolony--stimulatingfactor(MCSF)hasmultiplebiologicalactivities.M--CSFhadbeenprovedtoenhancetheresistanceofmonocyte--macrophagestoVSV[IJorHSV{2].TheantiviralactivityofM--CSFinfibroblastculturesinvitroandinguineapigormouseinvivohasalsobeendemonstrated[3--5].ItisreasonabletoinferthatM--CSFhasagreatpotentialityinclinicalapplicationintreatmentofvirusinfection.Inthispaper,westudiedtheantiviralactivityofsilkwormexpressedrecombinanthumanmacrophagecolony--stimulatingfactor(rhMCSF)i…     

Lipids, Lipoproteins and Apolipoproteins Abnormalities inPatients undergoing Dialysis

Patientswithchronicrenalfailureoftenhavehypertriglyceridemiaanddecreasedhigh-densitylipoproteincholesterol(HDL-C)concentrations[l'2].Whilecardiovasculardiseaseisamajorcauseofhighmorbidityandmortalityamongthesepatients['].Somestudiessuggestedthatabnormallipoproteinmetabolismwasoneofthecauses.InChina,fewreportswereavailableonlipids,lipoproteins,especiallyapolipoproteinsmetabolisminpatientsundergoingdialysis.Thepurposeofthisstudyistoobservethelipids,lipoproteinsandapolipoproteins(Apo)levelsinp…     

Gender difference of transmural heterogeneity of calcium current in rabbit ventricle

Femaleisassociatedwithanincreasedriskof torsadesdepointes(TdP)inthesettingofdrugs thatcanprolongtheQTinterval[1-3].Womenare twiceasmanyasmenandtheincidenceofsudden deathfromTdPishigherinwomenthaninmen. Thisphenomenonhasarousedgreatinterest[4,5].It isknownthatmid-myocardium(Mid)hasalonger actionpotentialdurationthantheepicardium(Epi) andendocardium(Endo),whichinducetransmural electricalheterogeneityintheheart.Transmural dispersionofrepolarization(TDR)providesthe substrateforthedevelopmento…     

Study on the relationship between plasma homocysteine and acute cerebral vascular disease

McCullyfoundvascularpathologicalchangesofinthepatientswithhyperhomocysteinemiaatfirst[l].Fromthenon,manyresearchersplayedtheirconcen-trationsonthisfield.Subsequently,similarphe-nomenonwasalsoseenintheanimalmodelandtvivitrotest.Especiallyintherecent5years,manycountriespaidattentiontothestudyoftherelation-shipbetweenplasmahomocysteine(Hcy)levelanda-cutecerebralvasculardisease(CVD)andtookmassprospectivestudiesandepidemiologicalinvestiga-tions[2].Ourcountryisa1sooneofhighmorbiditycountriesCVD,…     

Functional Role of Dendritic Cells in Patients with Unstable Angina

StudiesduringthelastdecadeidentifiedDCinatheroscleroticplaques.Dendriticcellsarepresentintheirimmatureformsinthearterialwallandareactivatedduringatherogenesis[1,2],whichprovidesanewapproachtoexplorethemechanismofT cellactivation[3].Dendriticcellsarefoundinaorticatheroscleroticlesionsinratswithdiet inducedhy percholesterolemia[4]andalsoinapolipoproteinE deficientmice[5].Dendriticcells(DC)wereoriginallydescribedbySteinmanandCohnin1973.Theyarethekeyantigen presentingcellsandarebelievedtoplaya…     

Effect of Fragment Asp1961-Glu1978 in Fibronectin on the Expression of Triple-domain Polypeptide in E. coli

Thebifunctional-domainrecombinantpolypeptldeoffibronectin(FN)ispotentiallyusefulintumortherapy.Thispolypeptideyieldedtheinhibltoryeffectontumormetastasisatseveralstepsoftumorcellsinvadingothertissuesll].ThestrongerfunctionwasobtainedifCell--ndomainwasconnectedtotheC--terminalofCellI--HepIpolypeptide['].Buttheexpressinglevelofthetriple--domainpolypeptideinE.coltwasverylow[ZJ.Wereportedthepreparationofbifunctional--domainrecombinantpolypeptideofFN,whichisProl239Ser1515ofFNlinkedwithAla16…     

Postsynaptic responses of the thoracic sympathetic preganglionic neurons to electrical stimulation of the rostral ventrolateral medulla in cats

Therostralventrolateralmedulla(RVLM)playsacriticalroleintheregulationofsympatheticnervousandcardiovascularfunctionll'2].PreviousreportshavedemonstratedthatneuronsinRVLMprojecteddirectlytotheintermediolateralcellcolumn(IMLC)ofthespinalcord[3.4],wheremostsympatheticpreganglionicneurons(SPNs)arelocated[5].AlthoughneuroanatomicaldatasuggestthatRVLMsympathoexcitatoryneuronsprojectmonosynapticallytoSPNs,thereislittledirectphysiologicalevidenceatpresent.Deuchars,atalL6]reportedthatelectrical…     

Effects of L-tetrahydropalmatine on energy metabolism, endothelin-1 and NO during acute cerebral ischemia-reperfusion of rats

L-tetrahydropalmatine(L-THP),akindofalkaloidextractedfromtraditionalChinesemedicineRhizomacorydalis,pos-sessessedative,analgesicandhypnoticef-fects.Recently,ithasbeendemonstratedthatL-THPalsohadeffectsofcalciuman-tagonistandantiarrhythmicdrugsL'].Maindicatedthatitcoulddecreaseplasmaen-dothelinconcentrations[2].RecentstudiesshowedthatL-THPalsohadaprotectiveeffectonfocalischemia-reperfusiondam-age['].Inthisstudy,weinvestigatedtheef-fectsofL-THPoncerebralATP,endothe-lin-1(ET-1)andNOcon…     

Acupuncture Treatment of Vomiting

CASE HISTORY A female patient, 46 years old, head of the foreign affairs department of a certain university in Beijing, paid her first visit on October 9, 2006, with the chief complaint of vomiting for one month. She got vomiting after meals in early September. Before that, she had discomfortable sensation in the stomach due to angry with others, but she didn't pay much attention. Later, it developed into vomiting after eating. After the vomiting, the discomfort would be relieved, but with slight hypodynamia. She was once diagnosed as having 'neurogenic vomiting'. Having taken some western and Chinese drugs, the above symptoms were a little bit improved, but she would have nausea upon eating and with regurgitation. Because of the fear for vomiting, she did not dare to have food intake, with body weight reduction of 6 kilos in one month.     

Qiu Baoguo''''s Experience in Treating Consumptive Syndromes after Radio-Chemotherapies

Radiotherapy and chemotherapy are the important modern medical therapies for malignant tumors,yet they can also bring about serious local and systemic toxic side reactions so to decrease the patient;'s life quality,manifested by a series of consumptive symptoms.Having engaged in the combined work of Chinese and western medicine for nearly 50 years,the research fellow Qiu Baoguo in Henan Provincial Academy of TCM has developed his unique views on the TCM study of consumptive syndromes.The author of this essay had once the fortune tO follow Dr.Qiu in clinic,and specially would like to introduce in the following Dr.Qiu's experience in treating consumptive syndromes after radio-chemotherapies for patients with malignant tumor.     

Insomnia Due to Deficiency of Both the Heart and Spleen Treated by Acupuncture-Moxibustion and Chinese Tuina

OBJECTIVE: To observe therapeutic effects of the comprehensive therapy of acupuncture-moxibustion and Chinese Tuina for treatment of insomnia due to deficiency of both the heart and spleen. METHODS: 92 cases were divided randomly into the treatment group (treated by acupuncture-moxibustion and Chinese Tuina) and the control group (treated by acupuncture-moxibustion). RESULTS: The therapeutic effect of the treatment group was obviously superior to that of the control group (the CHI2 test showed P < 0.01). CONCLUSIONS: The comprehensive therapy of acupuncture-moxibustion and Chinese Tuina can give marked therapeutic effects for treatment of insomnia due to deficiency of both the heart and spleen.     

Analysis of CK-19,PDX-1,Nestin,Ngn3 in different donor islet purity in rats

Objective: To investigate if there are the CK-19, PDX-1, Nestin, Ngn3 positive cells in the donor islets of different purity in rats. Methods: Thirty male adult SD rats were randomly divided into 3 groups. Islets were isolated using digestion by ductal injection of collagenase. Group Ⅰ (n=10): Separating cell preparations were not purified, Group Ⅱ(n=10): Islet sediment was purified with 25% Ficoll400 ,Group Ⅲ (n=10): Islet sediment was purified with 25% and 11% Ficoll-400. The levels of protein of CK-19, PDX-1, Nestin and Ngn3 were detected by immunohistochemistry and the mRNA of CK-19, PDX-1, Nestin, Ngn3 was amplified by RT-PCR. Results: After two different purification methods applied, three islet preparations of different purities were obtained. The difference of islet purity was significant among various groups (P＜0.05). Compared with group Ⅱ and group Ⅲ,the protein and mRNA of CK-19, PDX-1, Nestin,Ngn3 were both higher in group Ⅰ; group Ⅲ was poorly expressed. Conclusions: The three different islet purity donor islet have different CK-19, PDX-1, Nestin, Ngn3 positive cells within them, indicating that there are some islet stem cells in the purified donor islet.     

A preliminary screening study on the associated proteins in human psoriasis vulgaris by serum proteomics technologies

Objective：To investigate the optimum screening conditions of associated proteins in human psoriasis vulgaris by serum proteomics technique, and to screen the different expression proteins related with psoriasis vulgaris. Methods：Serum samples of peripheral blood were collected from newly diagnosed psoriasis vulgaris patients in the clinic, and 20 matched healthy persons. Serum albumin IgG was removed by filtering with ProteoExtract Albumin/IgG. After comparative proteomics analysis the different protein spots were identified using 2-DE and MS. Results ：Electrophoresis figures with high resolution and reproducibility were obtained. Three different expression proteins were found only in the serum from psoriasis vulgaris patients, while nine other different proteins expressing from healthy volunteers. Conclusion：The protein expression was different in the serum between the psoriasis vulgaris patients and healthy volunteers. It was hoped that we could find the biomarkers related to psoriasis vulgaris by using proteomics.     

A CASE OF HUGE GASTRIC DISOPYROBEZOAR

PYTOBEZOARS are common bezoars in gastrontestinal tract, commonly seen in stomach and mall intestine,1but huge disopyrobezoars are     

Acupuncture Treatment of Chest Bi Syndrome

CASE HISTORY A male,a retired officer of 61 years old,paid his first visit on May 12,2006.The patient stated that 2 weeks before he suddenly got paroxysmal precordial choking pain,with irregular attacks.Each attack would last several seconds to several minutes.The attack was accompanied with heavy oppressed sensation in the precordial region,palpitation,lassitude,and in severe cases,sweating,which was once diagnosed by a hospital as'coronary heart disease'.Recalling the case history,the patient said that several days before he got angry with others because of some affairs in work,and he was not so used to the life pattern since he had just retired from his busy working post.At usual times,he was quick tempered and peevish.In recent days,he had poor appetite,and loose stool.     

Instructions to Contributors

The English edition of Chinese Journal of Integrative Medicine is edited and published by the Chinese Journal of Integrated Traditional and Western Medicine Press.Original scientific papers of advanced clinical and experimental medicine in the field of complementary/alternative medicine or integrative medicine are expected.     

Development Is A High Level Inheritance for China Time-honored Brand Products

<正>As culture is the soul of a nation,the three books,"History of Chinese Philosophy,""History of Chinese Culture"and"History of Chinese Science and Technology"have demonstrated the superiority of our great Chinese culture,and its significant impact in the field of international culture.Both core value and practical value of the Chinese culture are very clear,reflected in the views of universe,nature,life,health,disease,and therapy and related considerations,concepts,and technical methods.